PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.1460s0066.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 270aa    MW: 30681.9 Da    PI: 4.5014
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.1460s0066.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.92.4e-2066119356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k++++t+eq++ Le+ F+ ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  Bostr.1460s0066.1.p  66 KKRRLTTEQVHLLEKSFATENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 119
                          56789************************************************9 PP

2HD-ZIP_I/II133.76.4e-4365157193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl++eqv+lLE+sF +e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l ++ +++ k++++Lr+e
  Bostr.1460s0066.1.p  65 EKKRRLTTEQVHLLEKSFATENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSE 154
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          +++
  Bostr.1460s0066.1.p 155 VTS 157
                          975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-2054123IPR009057Homeodomain-like
PROSITE profilePS5007117.81561121IPR001356Homeobox domain
SMARTSM003891.3E-1964125IPR001356Homeobox domain
PfamPF000462.0E-1766119IPR001356Homeobox domain
CDDcd000861.06E-1866122No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2167128IPR009057Homeodomain-like
PRINTSPR000313.9E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000313.9E-6101117IPR000047Helix-turn-helix motif
PfamPF021831.6E-16121163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MESNSFFFDP SASHGNMFFL GNINPVCQGG ARSMMNMEET SKRRPFFSSP EDLYDEEYYD  60
DQLPEKKRRL TTEQVHLLEK SFATENKLEP ERKTQLAKKL GLQPRQVAVW FQNRRARWKT  120
KQLERDYDLL KSTYDQLLSN YDSIVKDNDK LRSEVTSLTE ELQGKEETAN EPPGQVPEPN  180
QLDPVYINPA AIKTEDRLSS GSVGSAVLDE DAPQLLDSCD SYFPSIVPIH SQQDNNGCDN  240
DRSCFADVFV PTTSPSHDHG ESLGFWGWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0581880.0AY058188.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankAY0989720.0AY098972.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankX588210.0X58821.1 A.thaliana homeobox gene Athb-1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010496310.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022831e-175HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLR0HRX80.0R0HRX8_9BRAS; Uncharacterized protein
STRINGAT3G01470.11e-172(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88842738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-175homeobox 1